PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK23416.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 51aa    MW: 5860.67 Da    PI: 10.2329
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK23416.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM51.14.4e-1613505693
        NAM 56 kewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93
               + wyfFs++dkky+tg+r+nratk+g+Wkatg+dk+++
  PK23416.2 13 SLWYFFSHKDKKYPTGTRTNRATKAGFWKATGRDKAIY 50
               379*********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100519.164151IPR003441NAC domain
SuperFamilySSF1019411.09E-141450IPR003441NAC domain
PfamPF023654.3E-51547IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 51 aa     Download sequence    Send to blast
WVAMAMAGDD ELSLWYFFSH KDKKYPTGTR TNRATKAGFW KATGRDKAIY A
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_176457.16e-22NAC domain containing protein 26
SwissprotF4HYV58e-24NAC26_ARATH; NAC domain-containing protein 26
TrEMBLA0A0L9TR103e-21A0A0L9TR10_PHAAN; Uncharacterized protein
TrEMBLA0A0S3R5F13e-21A0A0S3R5F1_PHAAN; Uncharacterized protein
TrEMBLA0A151SKU24e-21A0A151SKU2_CAJCA; NAC domain-containing protein 7
TrEMBLV7CEB33e-21V7CEB3_PHAVU; Uncharacterized protein
STRINGAT1G62700.12e-21(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62700.15e-25Arabidopsis NAC domain containing protein 26